PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa14g009450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GATA
Protein Properties Length: 357aa    MW: 39695.8 Da    PI: 8.1576
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa14g009450.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA63.82e-20275309135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++C ttkTp+WR+gp+g+ktLCnaCG+++r+ +l
  Csa14g009450.1 275 CTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRL 309
                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577165.23E-15269331No hitNo description
SMARTSM004017.2E-20269319IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.084273305IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.9E-15273306IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.40E-17274323No hitNo description
PROSITE patternPS003440275300IPR000679Zinc finger, GATA-type
PfamPF003203.2E-18275309IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
ISQIRTCKSL NPQFETNSNF VIVRLFSLSL SLSLPILCGV CSQYIYKESS SMGSMNWLPE  60
QEEDFKGILS DDFFDDLINN LDCPLDDEDI DTTNAPDEEA LDWVAKFRDL EPPPMDMFPS  120
LPSHLTSLAK PARLVVQKQS SSSEGLSGIH STLHQSSSPP DIKVSKLFQS SSPVSVLVNS  180
CDSLSPQNSR PQGLAFPVKG MRSKRKRRTT VRLNYLFPFD EPRKPEKLTP GGSGSESYYS  240
SEQHAKKKRK IQLTTTHSVS SSFEASNSDG IVRKCTHCET TKTPQWREGP NGPKTLCNAC  300
GVRFRSGRLV PEYRPASSPT FIPSVHSNSH RKIIEMRRKD DNQFDTSMMH AVISGA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010458021.10.0PREDICTED: GATA transcription factor 11-like
SwissprotQ6DBP81e-154GAT11_ARATH; GATA transcription factor 11
TrEMBLR0IF881e-174R0IF88_9BRAS; Uncharacterized protein
STRINGAT1G08010.11e-152(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-132GATA transcription factor 11